Peci Kopiah Anak Karakter Motif Tayo / Songkok Mumtaza Berkualitas

Produk Dari pdp-os-icon Power Merchant

Stok terbatas! Tersedia >50
Dilihat
886
Transaksi Berhasil
100%(50 Produk)
Wishlist
10
Informasi Produk
  • Berat
    500 gram
  • Kondisi
    NEW
  • Pemesanan Min.
    1 Buah
  • Kategori
    1. Home
    2. Fashion Muslim
    3. Pakaian Muslim Pria
    4. Peci & Kopiah
  • Etalase

Deskripsi Produk

Sebelum bertransaksi dengan kami, mohon baca detail dan deskripsi tentang produk yang kami jual berikut ini :
Songkok anak motif tayo
Bahan bludru pandes countesa
Motif SABLON
Model atas tanpa AC
No 0 - 5
Ukuran lingkar kepala

0 : 49 cm
1 : 50 cm.
2 : 51 cm
3 : 52 cm
4 : 53 cm
5 : 54 cm

Tinggi 9
Merk Mumtaza
Dalaman pakaifuring


pecianakpecimotiftayosongkokpecitobotpeciupinipinpecianak songkokmurah peralatansholat pecianak pecidewasa grosirpecihaji pecidewasabusanamuslim pecibordir songkokberkualitas songkokhitampecihitampecisyafaatpecisusun Semua produk yang ada di etalase kami ready stok kak, silahkan langsung chek out ya kak. terimakasih,
Produk terkait
Logo MILLEA SHOP
shop_badgeMILLEA SHOP
locationKota Administrasi Jakarta Barat ยท 18 Sep 2019
badge
Terakhir Diperbaharui: 24-04-2019, 20:36 WIB